NBME CMS icon

NBME/CMS Analysis Dashboard

Summary

49Files discovered
49Files read
3380Question rows
3414Raw parsed rows
34Duplicate rows collapsed
3339Structurally usable rows
3328Pattern-ready rows
3708Parser warnings
99.3Average parse confidence

Parser Health

Parse Confidence

Confidence bandQuestions
high3353
medium7
low20
unknown0

Top Warnings

WarningCount
HL_choice_choice_missing_from_ans_ocr154
ref_stem_match:similarity=1.00,shared_terms=3284
ref_stem_match:similarity=1.00,shared_terms=2577
ref_stem_match:similarity=1.00,shared_terms=2772
ref_stem_match:similarity=1.00,shared_terms=2471
ref_stem_match:similarity=1.00,shared_terms=3070
ref_stem_match:similarity=1.00,shared_terms=4169
ref_stem_match:similarity=1.00,shared_terms=3367
ref_stem_match:similarity=1.00,shared_terms=2867
ref_stem_match:similarity=1.00,shared_terms=3165
trimmed_duple_ans_key_text64
ref_stem_match:similarity=1.00,shared_terms=3764

File Quality Triage

All NBME Files

All NBME files ranked by parse clean percentage. Use this to review structural usability first; pattern clean percentage is shown as secondary context.

Source fileTotal rowsParse-clean rowsParse excludedParse Clean %Pattern Clean %RecommendationTop warnings
NBME/NBME_15A.txt200198299.098.0Structurally usableref_stem_match:similarity=1.00,shared_terms=41 (9); ref_stem_match:similarity=1.00,shared_terms=37 (9); ref_stem_match:similarity=1.00,shared_terms=20 (9); ref_stem_match:similarity=1.00,shared_terms=24 (9); ref_stem_match:similarity=1.00,shared_terms=28 (7); ref_stem_match:similarity=1.00,shared_terms=43 (7)
NBME/NBME_9A.txt199197299.098.5Structurally usableref_stem_match:similarity=1.00,shared_terms=38 (12); ref_stem_match:similarity=1.00,shared_terms=48 (10); ref_stem_match:similarity=1.00,shared_terms=45 (8); ref_stem_match:similarity=1.00,shared_terms=47 (8); ref_stem_match:similarity=1.00,shared_terms=44 (6); ref_stem_match:similarity=1.00,shared_terms=37 (5)
NBME/NBME_10A.txt197196199.5100.0Structurally usableref_stem_match:similarity=1.00,shared_terms=37 (10); ref_stem_match:similarity=1.00,shared_terms=32 (9); ref_stem_match:similarity=1.00,shared_terms=36 (8); ref_stem_match:similarity=1.00,shared_terms=25 (8); ref_stem_match:similarity=1.00,shared_terms=30 (8); ref_stem_match:similarity=1.00,shared_terms=27 (8)
NBME/NBME_12A.txt200199199.599.0Structurally usableref_stem_match:similarity=1.00,shared_terms=32 (10); ref_stem_match:similarity=1.00,shared_terms=30 (9); ref_stem_match:similarity=1.00,shared_terms=43 (7); ref_stem_match:similarity=1.00,shared_terms=44 (7); ref_stem_match:similarity=1.00,shared_terms=39 (6); ref_stem_match:similarity=1.00,shared_terms=50 (6)
NBME/NBME_13A.txt198197199.599.0Structurally usableref_stem_match:similarity=1.00,shared_terms=40 (10); ref_stem_match:similarity=1.00,shared_terms=43 (9); ref_stem_match:similarity=1.00,shared_terms=35 (9); ref_stem_match:similarity=1.00,shared_terms=33 (8); ref_stem_match:similarity=1.00,shared_terms=32 (7); ref_stem_match:similarity=1.00,shared_terms=41 (7)
NBME/NBME_14A.txt200199199.5100.0Structurally usableref_stem_match:similarity=1.00,shared_terms=31 (9); ref_stem_match:similarity=1.00,shared_terms=28 (9); ref_stem_match:similarity=1.00,shared_terms=24 (9); ref_stem_match:similarity=1.00,shared_terms=42 (9); ref_stem_match:similarity=1.00,shared_terms=40 (8); ref_stem_match:similarity=1.00,shared_terms=46 (8)
NBME/NBME_11A.txt1991990100.099.0Structurally usableref_stem_match:similarity=1.00,shared_terms=41 (13); ref_stem_match:similarity=1.00,shared_terms=48 (8); ref_stem_match:similarity=1.00,shared_terms=46 (7); ref_stem_match:similarity=1.00,shared_terms=43 (7); ref_stem_match:similarity=1.00,shared_terms=25 (7); ref_stem_match:similarity=1.00,shared_terms=35 (6)

Worst CMS Files

Worst 10 CMS files by parse clean percentage. Use this to prioritize source cleanup without duplicate or pattern-only penalties driving the ranking.

Source fileTotal rowsParse-clean rowsParse excludedParse Clean %Pattern Clean %RecommendationTop warnings
CMS/EM_3A.txt5044688.0100.0Usable with cleanup targetsmissing_lead_in (6); ref_stem_match:similarity=1.00,shared_terms=35 (3); ref_stem_match:similarity=1.00,shared_terms=61 (3); ref_stem_match:similarity=1.00,shared_terms=41 (3); ref_stem_match:similarity=1.00,shared_terms=51 (2); ref_stem_match:similarity=1.00,shared_terms=34 (2)
CMS/FM_5A.txt3633391.791.7Structurally usabletrimmed_duple_ans_key_text (7); missing_lead_in (2); ref_stem_match:similarity=0.84,shared_terms=37 (1); ref_stem_match:similarity=0.76,shared_terms=22 (1); ref_stem_match:similarity=0.63,shared_terms=24 (1); ref_stem_match:similarity=0.16,shared_terms=5 (1)
CMS/Peds_4A.txt4845393.893.8Structurally usablemissing_answer_choices (3); missing_lead_in (3); ref_stem_match:similarity=0.89,shared_terms=34 (2); HL_choice_choice_missing_from_ans_ocr (2); ref_stem_match:similarity=1.00,shared_terms=19 (2); ref_stem_match:similarity=1.00,shared_terms=15 (2)
CMS/FM_4A.txt4038295.097.5Structurally usabletrimmed_duple_ans_key_text (5); ref_stem_match:similarity=0.80,shared_terms=32 (2); ref_stem_match:similarity=0.64,shared_terms=23 (2); ref_stem_match:similarity=0.94,shared_terms=48 (1); ref_stem_match:similarity=0.94,shared_terms=32 (1); ref_stem_match:similarity=0.95,shared_terms=39 (1)
CMS/Neuro_7A.txt4139295.195.1Structurally usableHL_choice_choice_missing_from_ans_ocr (37); ref_stem_match:similarity=1.00,shared_terms=44 (2); ref_stem_match:similarity=1.00,shared_terms=16 (2); ref_stem_match:similarity=1.00,shared_terms=75 (2); ref_stem_match:similarity=1.00,shared_terms=34 (2); ref_stem_match:similarity=1.00,shared_terms=49 (2)
CMS/PSYCH_4A.txt4846295.893.8Structurally usabletrimmed_duple_ans_key_text (6); choices_missing_correct_letter (2); missing_answer_choices (2); missing_lead_in (2); ref_stem_match:similarity=0.99,shared_terms=67 (1); ref_stem_match:similarity=1.00,shared_terms=28 (1)
CMS/PSYCH_6A.txt4846295.893.8Structurally usableref_stem_match:similarity=1.00,shared_terms=45 (3); ref_stem_match:similarity=1.00,shared_terms=29 (2); ref_stem_match:similarity=1.00,shared_terms=19 (2); ref_stem_match:similarity=1.00,shared_terms=73 (2); ref_stem_match:similarity=0.04,shared_terms=4 (2); ref_answer_stem_mismatch:similarity=0.03,shared_terms=2 (2)
CMS/EM_2A.txt5048296.096.0Structurally usableref_stem_match:similarity=1.00,shared_terms=40 (3); ref_stem_match:similarity=1.00,shared_terms=44 (3); ref_stem_match:similarity=1.00,shared_terms=52 (3); ref_stem_match:similarity=1.00,shared_terms=21 (3); ref_stem_match:similarity=1.00,shared_terms=61 (2); ref_answer_stem_mismatch:answer_stem_too_short (2)
CMS/OBGYN_8A.txt4140197.687.8Structurally usableHL_choice_choice_missing_from_ans_ocr (24); multiple_correct_ans_markers (4); ref_stem_match:similarity=1.00,shared_terms=38 (2); ref_stem_match:similarity=1.00,shared_terms=33 (2); ref_stem_match:similarity=1.00,shared_terms=11 (1); ref_stem_match:similarity=1.00,shared_terms=20 (1)
CMS/OBGYN_4A.txt4443197.797.7Structurally usableref_stem_match:similarity=1.00,shared_terms=32 (3); HL_choice_choice_missing_from_ans_ocr (3); ref_stem_match:similarity=1.00,shared_terms=43 (2); ref_stem_match:similarity=1.00,shared_terms=24 (2); ref_stem_match:similarity=1.00,shared_terms=22 (2); ref_stem_match:similarity=1.00,shared_terms=26 (2)

Parser Quality by File

Parser-focused failures ranked by parse usability. Pattern clean percentage is kept here only as secondary context.

Source fileParsed rowsParse-clean rowsParse Clean %Pattern Clean %Skipped expl.Synthetic rowsTrimmed duplicate keysTop skip reasons
CMS/EM_3A.txt504488.0100.0000missing_answer_key_and_choices (1)
CMS/Medicine_6A.txt504590.090.0000missing_answer_key_and_choices (4)
CMS/FM_5A.txt363391.791.7007
CMS/Peds_4A.txt494591.891.8001missing_answer_key_and_choices (1)
CMS/PSYCH_6A.txt504692.090.0000missing_answer_key_and_choices (1)
CMS/Neuro_7A.txt423992.992.9010missing_answer_key_and_choices (6)
CMS/Medicine_5A.txt494693.993.9100missing_answer_key_and_choices (4); starts_with_ocr_zero_choice (1)
CMS/FM_4A.txt403895.097.5005
CMS/OBGYN_8A.txt424095.285.7000missing_answer_key_and_choices (3)
CMS/PYSCH_3A.txt464495.795.7003missing_answer_key_and_choices (2)
CMS/PSYCH_4A.txt484695.893.8006
CMS/Surgery_8A.txt494795.993.9000missing_answer_key_and_choices (2)

Remaining Cleanup Targets

Cleanup Buckets

Cleanup bucketRows
other parser cleanup22
missing highlighted correct choice text12
low parse confidence9
highlighted correct choice recovered6
missing answer key2
possible OCR damage1

Lowest-confidence targets

Source fileQSectionSection QBucketRecommended actionConfidenceReasons
CMS/Peds_4A.txt43missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid0low parse confidence; missing correct answer text; correct letter not found in choices; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem; incomplete answer choices; ambiguous extracted lead-in
CMS/OBGYN_8A.txt4missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid32low parse confidence; missing correct answer text; correct letter not found in choices; choices_missing_correct_letter warning; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/EM_1A.txt37low parse confidencemanual parser review recommended35low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/EM_2A.txt39low parse confidencemanual parser review recommended35low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/FM_2A.txt44low parse confidencemanual parser review recommended35low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/Medicine_4A.txt20low parse confidencemanual parser review recommended35low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/Medicine_3A.txt29missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid45low parse confidence; missing correct answer text; correct letter not found in choices; choices_missing_correct_letter warning; incomplete answer choices; ambiguous extracted lead-in
CMS/PSYCH_4A.txt17missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid45low parse confidence; missing correct answer text; correct letter not found in choices; choices_missing_correct_letter warning; incomplete answer choices; ambiguous extracted lead-in
CMS/PSYCH_4A.txt49missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid45low parse confidence; missing correct answer text; correct letter not found in choices; choices_missing_correct_letter warning; incomplete answer choices; ambiguous extracted lead-in
CMS/Peds_4A.txt22missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid45low parse confidence; missing correct answer text; correct letter not found in choices; choices_missing_correct_letter warning; incomplete answer choices; ambiguous extracted lead-in
CMS/Peds_4A.txt42missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid45low parse confidence; missing correct answer text; correct letter not found in choices; choices_missing_correct_letter warning; incomplete answer choices; ambiguous extracted lead-in
CMS/Neuro_7A.txt26missing answer keyneeds answer key recovery50low parse confidence; missing correct answer; missing correct answer text; missing_answer_key warning
CMS/EM_2A.txt3low parse confidencemanual parser review recommended55low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/FM_5A.txt31low parse confidencemanual parser review recommended55low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/Neuro_3A.txt37low parse confidencemanual parser review recommended55low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/Neuro_4A.txt49missing answer keyneeds answer key recovery55low parse confidence; missing correct answer; missing correct answer text; missing_answer_key warning
CMS/OBGYN_4A.txt12missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid55low parse confidence; missing correct answer text; correct letter not found in choices; choices_missing_correct_letter warning; multiple correct-answer markers; incomplete answer choices
CMS/PEDS_6A.txt43missing highlighted correct choice textrepair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid55low parse confidence; missing correct answer text; correct letter not found in choices; choices_missing_correct_letter warning; incomplete answer choices
CMS/PSYCH_6A.txt39low parse confidencemanual parser review recommended55low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem
CMS/PSYCH_6A.txt40low parse confidencemanual parser review recommended55low parse confidence; reference-answer stem mismatch; ref_answer_stem_mismatch warning; reference stem does not match answer-file stem; duplicate-looking file/question

Reference Repair & File Review

Choice Source

Choice sourceFiles/questions
reference3120
ans_file_plus_reference154
answer_file106

File Review Priority

File review priorityFiles
Structurally usable48
Usable with cleanup targets1

Suggested Cleanup Action

Suggested actionFiles
manual review recommended22
repair answer choice OCR from Q_txt_ref or original PDF; correct answer letter may still be valid12
manual parser review recommended9
no manual cleanup needed; correct answer choice text was repaired from Q_txt_ref6
needs answer key recovery2
review OCR text against source PDF1

Reference Repair Audit

Shows whether Q_txt_ref files are repairing choices/stems or failing to match.

Source fileTotal rowsMatched refsMissing refsFailed refsFilled choicesCorrect choice repairsStill missing correct choiceMissing Q numsFailed Q nums
CMS/OBGYN_7A.txt493415001541111; 12; 20; 23; 27; 28; 33; 34; 35; 37; 38; 42; 43; 44; 50
CMS/FM_4A.txt402911001541115; 16; 17; 18; 20; 21; 22; 23; 25; 26; 27
CMS/FM_5A.txt3631400154111; 30; 34; 41
CMS/FM_2A.txt50472001541131; 45
CMS/Medicine_5A.txt46451001541147
CMS/Neuro_7A.txt414010015411unknown_1
CMS/OBGYN_6A.txt45441001541147
CMS/PSYCH_4A.txt48471001541126
CMS/PSYCH_6A.txt4845100154114
CMS/EM_1A.txt494800015411
CMS/EM_2A.txt504800015411
CMS/EM_3A.txt505000015411

Duplicate / Collision Audit

After NBME section mapping, this should mostly show true parser collisions rather than routine Q1-Q50 section repeats.

Source fileQSectionSection QCandidatesCollapsedRetained confidenceRef statusCandidate summary
CMS/Medicine_6A.txt243100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=B,has_correct_text=no,explanation_chars=1066; 2:dropped:confidence=100,warnings=2,choice_source=ans_file_plus_reference,ref=,correct=D,has_correct_text=no,explanation_chars=884; 3:dropped:confidence=32,warnings=2,choice_source=answer_file,ref=,correct=E,has_correct_text=no,explanation_chars=1109; 4:dropped:confidence=47,warnings=1,choice_source=answer_file,ref=,correct=B,has_correct_text=no,explanation_chars=492
CMS/Surgery_6A.txt332100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=A,has_correct_text=no,explanation_chars=1414; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=C,has_correct_text=no,explanation_chars=2256; 3:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=C,has_correct_text=no,explanation_chars=2339
CMS/FM_3A.txt4721100matched_reference1:dropped:confidence=50,warnings=2,choice_source=reference,ref=,correct=,has_correct_text=no,explanation_chars=0; 2:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=D,has_correct_text=no,explanation_chars=2537
CMS/Medicine_5A.txt121100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=D,has_correct_text=no,explanation_chars=1821; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=D,has_correct_text=no,explanation_chars=1980
CMS/Medicine_5A.txt621100matched_reference1:kept:confidence=100,warnings=2,choice_source=ans_file_plus_reference,ref=,correct=C,has_correct_text=no,explanation_chars=1488; 2:dropped:confidence=35,warnings=1,choice_source=answer_file,ref=,correct=D,has_correct_text=no,explanation_chars=1806
CMS/Medicine_5A.txt721100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=F,has_correct_text=no,explanation_chars=2010; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=A,has_correct_text=no,explanation_chars=2123
CMS/Medicine_6A.txt1021100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=D,has_correct_text=no,explanation_chars=612; 2:dropped:confidence=22,warnings=3,choice_source=answer_file,ref=,correct=E,has_correct_text=no,explanation_chars=1086
CMS/Medicine_8A.txt32192matched_reference1:kept:confidence=92,warnings=1,choice_source=reference,ref=,correct=A,has_correct_text=no,explanation_chars=2194; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=E,has_correct_text=no,explanation_chars=2496
CMS/Neuro_5A.txt221100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=B,has_correct_text=no,explanation_chars=2471; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=C,has_correct_text=no,explanation_chars=3651
CMS/Neuro_7A.txt3421100matched_reference1:dropped:confidence=50,warnings=2,choice_source=reference,ref=,correct=,has_correct_text=no,explanation_chars=0; 2:kept:confidence=100,warnings=2,choice_source=ans_file_plus_reference,ref=,correct=D,has_correct_text=no,explanation_chars=2530
CMS/OBGYN_5A.txt321100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=B,has_correct_text=no,explanation_chars=2608; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=C,has_correct_text=no,explanation_chars=3019
CMS/OBGYN_7A.txt221100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=B,has_correct_text=no,explanation_chars=3642; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=C,has_correct_text=no,explanation_chars=2729
CMS/OBGYN_7A.txt321100matched_reference1:dropped:confidence=100,warnings=2,choice_source=reference,ref=,correct=A,has_correct_text=no,explanation_chars=999; 2:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=A,has_correct_text=no,explanation_chars=2625
CMS/OBGYN_8A.txt321100matched_reference1:kept:confidence=100,warnings=2,choice_source=ans_file_plus_reference,ref=,correct=D,has_correct_text=no,explanation_chars=6800; 2:dropped:confidence=12,warnings=2,choice_source=answer_file,ref=,correct=C,has_correct_text=no,explanation_chars=3734
CMS/PEDS_5A.txt221100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=D,has_correct_text=no,explanation_chars=2626; 2:dropped:confidence=35,warnings=1,choice_source=answer_file,ref=,correct=E,has_correct_text=no,explanation_chars=2424
CMS/PEDS_5A.txt421100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=C,has_correct_text=no,explanation_chars=1466; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=B,has_correct_text=no,explanation_chars=2223
CMS/PEDS_8A.txt32185matched_reference1:kept:confidence=85,warnings=2,choice_source=answer_file,ref=,correct=C,has_correct_text=no,explanation_chars=140; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=B,has_correct_text=no,explanation_chars=2743
CMS/PSYCH_6A.txt3521100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=A,has_correct_text=no,explanation_chars=3467; 2:dropped:confidence=100,warnings=1,choice_source=reference,ref=,correct=B,has_correct_text=no,explanation_chars=2490
CMS/PSYCH_6A.txt4621100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=B,has_correct_text=no,explanation_chars=2150; 2:dropped:confidence=100,warnings=1,choice_source=answer_file,ref=,correct=H,has_correct_text=no,explanation_chars=2576
CMS/PYSCH_3A.txt221100matched_reference1:kept:confidence=100,warnings=1,choice_source=reference,ref=,correct=D,has_correct_text=no,explanation_chars=5965; 2:dropped:confidence=55,warnings=1,choice_source=answer_file,ref=,correct=A,has_correct_text=no,explanation_chars=4821

Pattern Overview

Archetypes

ArchetypeQuestionsTop lead-insCommon stem cues
Diagnosis494most likely diagnosis; most likely causal organism; f the following is the most likely diagnosis; most likely infectious agent; step in diagnosis; which of the following studies is most likely to establish the diagnosispulse; pressure; respirations; illness; loss; cough; left; right; weight; takes; tenderness; medications
Next best step / management461most appropriate next step in management; most appropriate next step; most appropriate next step in pharmacotherapy; f the following is the most appropriate next step in management; most appropriate management; most appropriate course of actionpulse; pressure; respirations; right; medications; hypertension; tenderness; takes; serum; physician; illness; emergency
Other / unclear276[missing]; which of the following abnormalities; which of the following conditions; which of the following sites; which of the following locations; most likely location of the abnormalitypulse; respirations; pressure; serum; left; right; hypertension; medications; takes; cancer; illness; onset
Adverse effect179most likely cause of this patient's symptoms; most likely explanation for these findings; most likely cause of these findings; most likely cause of this patient's condition; most likely underlying cause of this patient's symptoms; most likely causepulse; hypertension; pressure; progressive; two; illness; laboratory; respirations; vaginal; medications; shortness; diabetes
Mechanism / pathophysiology163most likely explanation for these findings; most likely cause of these findings; most likely cause; most likely cause of this patient's symptoms; most likely cause of this patient's condition; most likely underlying cause of these findingspulse; pressure; serum; two; left; progressive; loss; diarrhea; diabetes; fetal; breath; right
Diagnostic test143most appropriate next step in diagnosis; most likely to confirm the diagnosis; most appropriate next step in evaluation; most appropriate next step to confirm the diagnosis; following is the most appropriate next step in diagnosis; most appropriate diagnostic testpulse; right; left; respirations; loss; pressure; serum; progressive; tenderness; intermittent; weight; hypertension
Treatment selection92most appropriate pharmacotherapy; most appropriate treatment; most appropriate treatment for this patient; most appropriate pharmacotherapy at this time; most appropriate pharmacotherapy for this patient; which of the following properties is the most appropriate treatmentpulse; medications; mild; respirations; illness; erythema; pharmacotherapy; pressure; fatigue; intermittent; takes; vomiting
Screening / prevention91most appropriate recommendation for this patient; most appropriate recommendation; most appropriate screening test for this patient; which of the following vaccines is most appropriate at this time; most appropriate vaccine to administer at this time; most likely to have prevented her symptomsillness; screening; hypertension; prevent; takes; age; cancer; medications; right; serum; vaccine; pressure
Initial management39most appropriate initial step in management; most appropriate initial pharmacotherapy; most appropriate initial step in diagnosis; most appropriate initial management; most appropriate initial treatment; appropriate initial step in management is administration of which of the followingpulse; hypertension; respirations; medications; sudden; headache; pressure; difficulty; mood; ecg; cardiac; distal
Interpretation of lab/imaging35most likely to be increased in this patient; which of the following hormones; which of the following substances is the most likely cause of this patient's symptoms; which of the following laboratory results are most likely in this patient; which of the following laboratory results is most likely to show a greater sencun mui elcmemnse; active range of motion. plain x-rays of the knee show periarticular osteopenia; the joint space is narrowed medially. wisirsmucn om" enunmss8- ss scones asics managementserum; pulse; respirations; brain; three; progressive; irregular; concentrations; medications; concentration; pressure; laboratory
Risk factor18greatest risk for which of the following; strongest predisposing factor for this patient's condition; strongest predisposing factor for cerebral infarction in this patient; strongest predisposing factor for osteoarthritis in this patient during the next 10 years; this patient's greatest risk factor for his neurologic condition; which of the following historical findings is the greatest risk factor for osteoporotic fracture in this patientfactor; hypertension; age; mild; treated; vaginal; right; left; eye; neurologic; small; fracture
Ethics / communication16most appropriate physician response; most appropriate response; most appropriate response by the physician; necessary to discuss with the patient in order to obtain informed consent for this procedure; most accurate statement concerning the patient's situation; these symptoms are most likely to respond to treatment with which of the followingphysician; response; pulse; all; progressive; medications; says; mother; son; vital; treated; health
Complication13which of the following complications; which of the following complications is this patient at increased risk; most serious complication of this condition; which of the following obstetric complications; show periosteal new bone formation of the femurs. her symptoms are most likely a complication of which of the following; most likely to decrease this patient's risk for pulmonary complicationsfatigue; complications; illness; gestation; fetal; laboratory; pulse; count; pregnancy; cervix; weight
Prognosis6which of the following historical findings represents the strongest mortality risk factor for this patient during the next 10 years; most appropriate pharmacotherapy to improve this patient's chances of survival; patient is associated with the worst prognosis; strongest predisposing risk factor for this patient’s in-hospital mortality; which of the following factors is most predictive of a poor prognosis in this patient; most important factor in this patient's history and physical examination in determining his prognosisserum; exertion; dyspnea

Top Exclusion Reasons

ReasonQuestions
duplicate-looking file/question22
low parse confidence21
missing correct answer text14
correct letter not found in choices12
reference-answer stem mismatch11
ref_answer_stem_mismatch warning11
reference stem does not match answer-file stem11
choices_missing_correct_letter warning11
incomplete answer choices8
multiple correct-answer markers7
ambiguous extracted lead-in6
missing correct answer2

Broad Pattern Summary

ArchetypePattern typePhrase/featureQuestionsConfidence
Diagnosislead_inmost likely diagnosis431low
Next best step / managementdistractor_familyimaging380low
Next best step / managementlead_inmost appropriate next step in management349low
Diagnosisdistractor_familyimaging286low
Diagnostic testdistractor_familyimaging212low
Adverse effectdistractor_familyimaging129low
Mechanism / pathophysiologydistractor_familyimaging121low
Diagnostic testdistractor_familylab / culture / serology116low
Diagnostic testlead_inmost appropriate next step in diagnosis109low
Next best step / managementdistractor_familycardiovascular medication107low
Diagnosiscorrect_answer_termdisorder97low
Next best step / managementdistractor_familyprocedure / surgery91low
Diagnosisdistractor_familyneoplasm / malignancy82low
Next best step / managementstem_cuepulse82low
Next best step / managementdistractor_familyantibiotic / antimicrobial81low
Diagnosisstem_cuepulse70low
Next best step / managementdistractor_familylab / culture / serology68low
Next best step / managementstem_cuepressure57low
Diagnosiscorrect_answer_termloss56low
Next best step / managementdistractor_familyintravenous55low
Next best step / managementdistractor_familyadministration51low
Diagnostic testdistractor_familyprocedure / surgery49low
Treatment selectionlead_inmost appropriate pharmacotherapy49low
Next best step / managementcorrect_answer_termdisorder48low
Next best step / managementdistractor_familysteroid / immunosuppression48low

High-Yield Clues

Anchor Clues

RefArchetypeLikely anchor cluesDecisive clues
CMS/EM 1A.txt Q1Next best step / managementshortness breath; pressure; heart; edema; emergency; shortness; breath; hypertension; medications; says
CMS/EM 1A.txt Q2Other / unclearpleuritic chest; chest pain; pneumonia; chills; cough; pleuritic; multiple; myeloma; tactile; fremitus
CMS/EM 1A.txt Q3Mechanism / pathophysiologyear; loss; hearing; external; auditory; gasoline; exploded; abrasions; right; pulse
CMS/EM 1A.txt Q4Treatment selectionecg; pneumonia; renal; failure; dementia; vomiting; produced; abdomen; soft; fingerstick
CMS/EM 1A.txt Q5Treatment selectionoperating outboard; outboard motor; treated; motor; headache; nausea; operating; outboard; progressive; hypertension
CMS/EM 1A.txt Q6Next best step / managementpulse; treated; pressure; seizure; clammy; skin; hypertension
CMS/EM 1A.txt Q7Next best step / managementpressure; hypertension; pulse; murmur; x-ray; ecg; upper; back; heard; leftcardiac examination discloses diastolic low-pitched murmur best heard at; there is no peripheral edema chest x-ray and ecg
CMS/EM 1A.txt Q8Next best step / managementwater; girl; breath; air; lungs; fell; off; pulse; respirations; external
CMS/EM 1A.txt Q9Next best step / managementconcentration; lactate; red; hemoglobin; laboratory; serum; tachycardia; feeling; light-headed; stoolfingerstick blood glucose concentration is 92 mg/dl 5 11; fingerstick blood glucose concentration is 92 mg/dl (5
CMS/EM 1A.txt Q10Other / unclearcommunicate; interpreter; malignancy; cough; low-grade; pulse; respirations; x-ray; evidence
CMS/EM 1A.txt Q11Next best step / managementright lower quadrant; right lower; lower quadrant; abdominal pain; right; quadrant; tenderness; palpation; nausea; negative
CMS/EM 1A.txt Q12Adverse effectepigastric; amylase; lipase; three; treated; upper; direct; onset; diffuse; tenderness
CMS/EM 1A.txt Q13Next best step / managementasthma; albuterol; cough; metered-dose; respiratory; distress; six; progressive; shortness; remainder
CMS/EM 1A.txt Q14Next best step / managementtenderness; pelvic; emergency; onset; nausea; adnexal; pregnancy; sudden; illness; takesno cervical motion tenderness
CMS/EM 1A.txt Q15Next best step / managementtesticular pain; tenderness palpation; cremasteric reflex; testicular; testis; tenderness; palpation; cremasteric; reflex; emergency
CMS/EM 1A.txt Q16Next best step / managementwound; bitten; right; avulsion; injury; unremarkable; takes
CMS/EM 1A.txt Q17Other / unclearserum; fatigue; generalized; weakness; dry; mucous; pulse; respirations; studies; takes
CMS/EM 1A.txt Q18Treatment selectionshortness breath; muscle; diaphoresis; weakness; excessive; decontamination; shortness; breath; oxygen; lacrimation
CMS/EM 1A.txt Q19Next best step / managementchest pain; leaning forward; friction rub; jugular venous; venous distention; leaning; forward; ecg; left; auscultation
CMS/EM 1A.txt Q20Diagnostic testlower abdominal; menstrual period; pelvic; tenderness; menstrual; period; adnexal; dlay; nausea; abdomen
CMS/EM 1A.txt Q21Diagnosisleft lower extremity; lower extremity held; extremity held external; held external rotation; lower extremity; bear weight; left lower; extremity held; held external; external rotation
CMS/EM 1A.txt Q22Other / unclearmajor depressive; depressive disorder; suicide; plan; suicidal; organized; factors; major; depressive; disorder
CMS/EM 1A.txt Q23Mechanism / pathophysiologysunken anterior; dry mucous; parents; water; sunken; anterior; dry; mucous; membranes; hypotension
CMS/EM 1A.txt Q24Next best step / managementweight loss; heart; palpitations; weight; loss; medications; neck; illness; takes; remainder
CMS/EM 1A.txt Q25Next best step / managementvaginal bleeding; abdominal pain; postpartum; uterine; bleeding; vaginal; delivery; ultrasonography; echogenic; material

Decisive Clues

RefArchetypeDecisive cluesCorrect supportDistractor support
CMS/EM 1A.txt Q1Next best step / managementshortness; breath; hypertension; edema; pulmonary edema; edema heart; pulmonary edema heartcoronary; artery; edema; pulmonary edema
CMS/EM 1A.txt Q2Other / unclearpneumonia; pneumococcal pneumonia; community-acquired pneumonia; tactile; fremitus; x-raypneumonia; pneumococcal pneumonia; pneumonia immunocompromised; community-acquired pneumonia; pneumocystis pneumonia
CMS/EM 1A.txt Q3Mechanism / pathophysiologyear; antibiotic ear; ear drops; antibiotic ear dropsear
CMS/EM 1A.txt Q4Treatment selection
CMS/EM 1A.txt Q5Treatment selectionheadache; nausea; operating; outboard; motor; treated; treated hyperbaric; treated hyperbaric oxygen
CMS/EM 1A.txt Q6Next best step / managementtreated; withdrawal treated; treated benzodiazepines; alcohol withdrawal treated; withdrawal treated benzodiazepines
CMS/EM 1A.txt Q7Next best step / managementcardiac examination discloses diastolic low-pitched murmur best heard at; there is no peripheral edema chest x-ray and ecgmurmur; heard; dissection murmur; murmur aortic; regurgitation heard; x-ray; ecg; chest x-rayecg; ecg elevation; ecg elevation similar; x-ray
CMS/EM 1A.txt Q8Next best step / management
CMS/EM 1A.txt Q9Next best step / managementfingerstick blood glucose concentration is 92 mg/dl 5 11; fingerstick blood glucose concentration is 92 mg/dl (5concentration; hemoglobin concentration; concentration lags; hemoglobin concentration lags; concentration lags behind
CMS/EM 1A.txt Q10Other / unclearinterpreter; interpreter issuing; interpreter issuing discharge; wait interpreter; waiting interpreterinterpreter
CMS/EM 1A.txt Q11Next best step / managementright; quadrant; tenderness; palpation; migrate rightright; quadrant; right lower; lower quadrant; right lower quadrant
CMS/EM 1A.txt Q12Adverse effectdirect; epigastric; epigastric paindirect; bilirubin; pancreatitis direct; direct bilirubin; bilirubin classic; upper; right upper; upper quadrant
CMS/EM 1A.txt Q13Next best step / managementalbuterol; metered-dose; nebulized albuterol; albuterol asthma; agonists albuterol; asthma; asthma exacerbations; asthma reversible
CMS/EM 1A.txt Q14Next best step / managementno cervical motion tendernesstenderness; mass tenderness; adnexal mass tenderness
CMS/EM 1A.txt Q15Next best step / managementtenderness; palpation; pain tenderness; tenderness palpation; palpation scrotal; cremasteric; reflex; negative cremasterictenderness; cremasteric; reflex
CMS/EM 1A.txt Q16Next best step / management
CMS/EM 1A.txt Q17Other / unclearfatigue; oka fatigue; fatigue polyuria; oka fatigue polyuria; fatigue polyuria polydipsia; serumserum; hyperglycemia serum; serum concentration; cells serum; diuresis hyperglycemia serum
CMS/EM 1A.txt Q18Treatment selectiondiaphoresis; excessive; weaknessshortness; breath
CMS/EM 1A.txt Q19Next best step / management
CMS/EM 1A.txt Q20Diagnostic testtenderness; adnexalsuprapubic; tenderness
CMS/EM 1A.txt Q21Diagnosisextremity; lower extremity; rotated lower extremity; held; external; rotation; rotated lower; externally rotated lowerextremity; external; extremity shortening; shortening external; external rotation; rotation; extremity shortening external; weight extremity
CMS/EM 1A.txt Q22Other / unclear
CMS/EM 1A.txt Q23Mechanism / pathophysiologysunken; anterior; dry; mucous; membranes
CMS/EM 1A.txt Q24Next best step / managementpalpitations; heart
CMS/EM 1A.txt Q25Next best step / managementtenderness; bleeding; uterine bleeding; significant uterine bleeding; vaginal; postpartum vaginalvaginal; bleeding; vaginal packing; vaginal bleeding; cells vaginal

Correct vs Distractor Patterns

ArchetypeStem cueCorrect familyDistractor familyContrast signalConfidence
Next best step / managementabdomenprocedure / surgeryimagingkeyed terms: abdomen; laparotomy; surgical; viscus; perforated | distractor terms: abdomen; gastrointestinal; x-ray; upper; study3medium
Next best step / managementabdomenimaginglab / culture / serologykeyed terms: abdomen; infants; gastric; dehydration; stenosis | distractor terms: metabolic; abdomen; derangements; stenosis; pyloric stenosis3medium
Diagnosismoodmajoradjustmentkeyed terms: depressive; neurovegetative; mod; disturbance; disorder | distractor terms: depressive; disorder; depressed; adjustment; dementia alzheimer3medium
Diagnosisbreastimagingneoplasm / malignancykeyed terms: papilloma; benign; breast; bloody; nipple | distractor terms: abscess; breast; cancer; fibrocystic; carcinoma3medium
Diagnosisbreastimagingbreastkeyed terms: papilloma; benign; breast; bloody; nipple | distractor terms: abscess; breast; cancer; fibrocystic; carcinoma3medium
Next best step / managementwaterobservation / reassurancecardiovascular medicationkeyed terms: admission; hospital; observation; leads; ards | distractor terms: pulmonary; antibiotic; drowning; diuretic; corticosteroid2medium
Next best step / managementtendernessimagingantibiotic / antimicrobialkeyed terms: ultrasonography pelvis; ovary; torsion; ovarian; ultrasonography | distractor terms: torsion; ceftriaxone; ovarian; hospital; surgical2medium
Diagnostic testrightimaginglab / culture / serologykeyed terms: urinary; flank; abdomen; hematuria; calcium | distractor terms: cystoscopy; series; stones; uric; uric acid2medium
Diagnostic testflankimaginglab / culture / serologykeyed terms: abdomen; urinary; flank; hematuria; calcium | distractor terms: serum; x-ray; acid; cystoscopy; series2medium
Next best step / managementvenousneedleresuscitation / fluidskeyed terms: pleural; pneumothorax; thoracostomy; lung; space | distractor terms: pneumothorax; saline; decompression; thoracostomy; thoracotomy2medium
Next best step / managementbreathneedleresuscitation / fluidskeyed terms: pleural; pneumothorax; thoracostomy; lung; space | distractor terms: pneumothorax; saline; decompression; thoracostomy; thoracotomy2medium
Diagnostic testpressureimaginglab / culture / serologykeyed terms: head; noncontrast; onset; sah; subarachnoid | distractor terms: rate; mri; carotid; temporal; eeg2medium
Next best step / managementbreath soundsneedleimagingkeyed terms: pneumothorax; tension; needle; tension pneumothorax; air | distractor terms: pneumothorax; tension; x-ray; diagnostic; tracheal2medium
Next best step / managementbreath soundsneedleprocedure / surgerykeyed terms: pneumothorax; tension; needle; tension pneumothorax; air | distractor terms: pneumothorax; tension; x-ray; diagnostic; tracheal2medium
Next best step / managementpressurecardiovascular medicationa-adrenergickeyed terms: pressure; diabetic; foot; gabapentin; alternative | distractor terms: inhibitor; agent; blocking; diabetic; diabetic neuropathy2medium
Next best step / managementpressurecardiovascular medicationangiotensin-receptorkeyed terms: pressure; diabetic; foot; gabapentin; alternative | distractor terms: inhibitor; agent; blocking; diabetic; diabetic neuropathy2medium
Mechanism / pathophysiologydiarrhealab / culture / serologyimagingkeyed terms: intraepithelial; bowel; small; proximal; celiac | distractor terms: diarrhea; anemia; folic; concentration; bloating2medium
Next best step / managementpubic hairobservation / reassuranceimagingkeyed terms: growth; puberty; begun; follow-up; thelarche | distractor terms: breast; antibiotic; breast mass; biopsy; thelarche2medium
Next best step / managementbreastobservation / reassurancemammographykeyed terms: breast; begun; follow-up; thelarche; young | distractor terms: antibiotic; biopsy; mammography; breast; breast mass2medium
Next best step / managementbreastobservation / reassuranceimagingkeyed terms: breast; begun; follow-up; thelarche; young | distractor terms: antibiotic; biopsy; mammography; breast; breast mass2medium
Diagnosismenstrual periodimagingappendicitiskeyed terms: bleeding; ectopic; pregnancy; ectopic pregnancy; tenderness | distractor terms: vaginal; bleeding; vaginal bleeding; appendicitis; abortion2medium
Diagnosisvaginalimagingappendicitiskeyed terms: bleeding; ectopic; pregnancy; ectopic pregnancy; tenderness | distractor terms: vaginal; bleeding; vaginal bleeding; appendicitis; abortion2medium
Next best step / managementback painimagingbedkeyed terms: lumbosacral; back; lumbar disc herniation; disc herniation; lumbar | distractor terms: bed; injection; rest; epidural; mri2medium
Other / unclearmedicationslab / culture / serologyimagingkeyed terms: cardiac; endocardilis; procedures; prophylaxis; heart | distractor terms: antibiotic; valvular; whether; prophylaxis; prophylaxis dental2medium
Diagnostic testchest painimaginglab / culture / serologykeyed terms: angiography; pulmonary; syncope; shortness; suggestive | distractor terms: mixed; saturation; lower extremity; oxygen saturation; extremity2medium

NBME Rule Candidates

Rules are candidate heuristics from repeated answer-choice contrasts. Treat low-confidence rows as review prompts, not facts.

Rule candidateDecision frameClue patternCorrect familyTempting distractorEvidenceConfidencePriorityRefs
Local pattern: vaginal bleeding + next best step / management -> supportive care / reassurance over cardiovascular medication.no_treatment_reassurancevaginal bleedingsupportive care / reassurancecardiovascular medication; coagulation profile; intravenous administration of magnesium sulfate3mediummediumCMS/OBGYN 5A Q30; CMS/OBGYN 6A Q4; CMS/OBGYN_7A Q36
Local pattern: comes physician lesion + next best step / management -> procedure: surgery over imaging.treatment_threshold_metcomes physician lesionprocedure: surgeryimaging; procedure: biopsy2mediummediumCMS/Medicine 3A Q42; CMS/Medicine 5A Q32
Local pattern: vaginal bleeding + next best step / management -> imaging over dilatation and curettage.contraindication_or_adverse_effectvaginal bleedingimagingdilatation and curettage; lab / culture / serology2mediummediumCMS/OBGYN 4A Q35; CMS/OBGYN_7A Q38

Decision Contrast Rules

Decision frameStem triggerCorrect familyTempting distractorEvidenceConfidenceRuleRefs
next_best_test_after_initial_cluehe smoked one and one-half packs of cigarettes dailyimagingcardiac stress scintigraphy2mediumWhen 'he smoked one and one-half packs of cigarettes daily' appears, local explanations/choice text favor imaging over cardiac stress scintigraphy; keyed terms: subclavian steal, vertigo lightheadedness, upper extremity, subclavian artery | distractor terms: cardiac stress, observes myocardial, myocardial perfusion, perfusion rest; weakened by local missing/negative features: no abnormalities, not recall any trauma to his left arm, not had any other symptoms, no history of serious illness and takes no. Close-distractor signal: choice-specific explanation shares local terms: left arm, plays tennis, cardiac stress.CMS/Neuro 4A Q22; NBME_15A Q40
diagnostic_cluster_vs_mimiche does not drink alcohol or use illicit drugsbipolar disorderschizophrenia2mediumWhen 'he does not drink alcohol or use illicit drugs' appears, local explanations/choice text favor bipolar disorder over schizophrenia; keyed terms: bipolar disorder, type bipolar, type bipolar disorder, thinking evidenced | distractor terms: delusions hallucinations, hallucinations disorganized, chronic course, course delusions; weakened by local missing/negative features: not drink alcohol or use illicit drugs, no medications, without evidence of residual symptoms or impaired functionality, and/or negative, no other abnormalities. Close-distractor signal: choice-specific explanation shares local terms: messiah police, lawyer brought, department police.CMS/PSYCH 5A Q13; CMS/PYSCH 3A Q23
treatment_threshold_metbeing stabbed in anterior neck 30 minutes agoprocedure: airway/supporttracheostomy2mediumWhen 'being stabbed in anterior neck 30 minutes ago' appears, local explanations/choice text favor procedure: airway/support over tracheostomy; keyed terms: airway obstruction, endotracheal intubation, obstruction immediate, immediate life-threatening | distractor terms: securing airway, airway via, via laryngoscopy, laryngoscopy unsuccessful; weakened by local missing/negative features: not be possible if hematoma overlies the. Close-distractor signal: choice-specific explanation shares local terms: department stabbed, stabbed anterior, anterior neck.CMS/Surgery 3A Q6; CMS/Surgery_5A Q3
diagnostic_cluster_vs_mimicmild weakness of right lower extremitymeningiomaschwannoma2mediumWhen 'mild weakness of right lower extremity' appears, local explanations/choice text favor meningioma over schwannoma; keyed terms: meningioma benign, benign central, central nervous, nervous system | distractor terms: benign tumors, tumors arise, arise schwann, schwann cells; weakened by local missing/negative features: for primary lesion is negative. Close-distractor signal: choice-specific explanation shares local terms: department simple, simple partial, partial seizure.CMS/Neuro 5A Q3; CMS/Neuro 6A Q37
diagnostic_cluster_vs_mimicmild weakness of right lower extremitymeningiomaastrocytoma2mediumWhen 'mild weakness of right lower extremity' appears, local explanations/choice text favor meningioma over astrocytoma; keyed terms: meningioma benign, benign central, central nervous, nervous system | distractor terms: primary cns, cns neoplasm, neoplasm benign, benign pilocytic; weakened by local missing/negative features: for primary lesion is negative. Close-distractor signal: choice-specific explanation shares local terms: department simple, simple partial, partial seizure.CMS/Neuro 5A Q3; CMS/Neuro 6A Q37
diagnostic_cluster_vs_mimicsimple partial seizuremeningiomaschwannoma2mediumWhen 'simple partial seizure' appears, local explanations/choice text favor meningioma over schwannoma; keyed terms: meningioma benign, benign central, central nervous, nervous system | distractor terms: benign tumors, tumors arise, arise schwann, schwann cells; weakened by local missing/negative features: for primary lesion is negative. Close-distractor signal: choice-specific explanation shares local terms: department simple, simple partial, partial seizure.CMS/Neuro 5A Q3; CMS/Neuro 6A Q37
diagnostic_cluster_vs_mimicsimple partial seizuremeningiomaastrocytoma2mediumWhen 'simple partial seizure' appears, local explanations/choice text favor meningioma over astrocytoma; keyed terms: meningioma benign, benign central, central nervous, nervous system | distractor terms: primary cns, cns neoplasm, neoplasm benign, benign pilocytic; weakened by local missing/negative features: for primary lesion is negative. Close-distractor signal: choice-specific explanation shares local terms: department simple, simple partial, partial seizure.CMS/Neuro 5A Q3; CMS/Neuro 6A Q37
no_treatment_reassurancehyperthyroidism treated with propylthiouracil and tachycardia controlled with labetalolsupportive care / reassuranceintravenous administration of magnesium sulfate1lowWhen 'hyperthyroidism treated with propylthiouracil and tachycardia controlled with labetalol' appears, local explanations/choice text favor supportive care / reassurance over intravenous administration of magnesium sulfate; keyed terms: cesarean delivery, placenta previa, third trimester, vaginal bleeding | distractor terms: preeclampsia hypertension, hypertension proteinuria, proteinuria end-organ, end-organ dysfunction; weakened by local missing/negative features: no abnormalities, no contractions, no decelerations and normal variability, normal variability, not typically cause vaginal bleeding. Close-distractor signal: choice-specific explanation shares local terms: vaginal bleeding, comes physician, biopsy specimen.CMS/OBGYN_7A Q36
no_treatment_reassurancehyperthyroidism treated with propylthiouracil and tachycardia controlled with labetalolsupportive care / reassuranceamnioinfusion1lowWhen 'hyperthyroidism treated with propylthiouracil and tachycardia controlled with labetalol' appears, local explanations/choice text favor supportive care / reassurance over amnioinfusion; keyed terms: cesarean delivery, placenta previa, third trimester, vaginal bleeding | distractor terms: refers process, process instilling, instilling fluid, fluid uterus; weakened by local missing/negative features: no abnormalities, no contractions, no decelerations and normal variability, normal variability, not used in treatment of placenta previa. Close-distractor signal: choice-specific explanation shares local terms: fetal heart, comes physician, vaginal bleeding.CMS/OBGYN_7A Q36
contraindication_or_adverse_effectshe is receiving maintenance chemotherapy and trimethoprim-sulfamethoxazole prophylaxisherpes zosterleukemic relapse1lowWhen 'she is receiving maintenance chemotherapy and trimethoprim-sulfamethoxazole prophylaxis' appears, local explanations/choice text favor herpes zoster over leukemic relapse; keyed terms: herpes zoster, varicella zoster, zoster virus, varicella zoster virus | distractor terms: leukemia cutis, rash form, form leukemia, cutis leukemia; weakened by local missing/negative features: not vesicles. Close-distractor signal: choice-specific explanation shares local terms: leukemia cutis, girl remission, remission lymphoblastic.CMS/Peds 4A Q1
contraindication_or_adverse_effectshe is receiving maintenance chemotherapy and trimethoprim-sulfamethoxazole prophylaxisherpes zosterimaging1lowWhen 'she is receiving maintenance chemotherapy and trimethoprim-sulfamethoxazole prophylaxis' appears, local explanations/choice text favor herpes zoster over imaging; keyed terms: herpes zoster, varicella zoster, zoster virus, varicella zoster virus | distractor terms: toxic epidermal, epidermal necrolysis, necrolysis ten, ten cutaneous; weakened by local missing/negative features: without spreading would be highly uncharacteristic of ten. Close-distractor signal: choice-specific explanation shares local terms: drug reaction, girl remission, remission lymphoblastic.CMS/Peds 4A Q1
treatment_threshold_methypertension treated with hydrochlorothiazide and osteoarthritis treated with acetaminoantibiotic / antimicrobialassess booster phenomenon1lowWhen 'hypertension treated with hydrochlorothiazide and osteoarthritis treated with acetamino' appears, local explanations/choice text favor antibiotic / antimicrobial over assess booster phenomenon; keyed terms: benign murmurs, otherwise healthy, apparent factors, factors cardiac | distractor terms: recommended torsades, torsades pointes, pointes congenital, congenital long; weakened by local missing/negative features: no sick contacts, no abnormalities, not smoke cigarettes, not to play competitive sports. Close-distractor signal: choice-specific explanation shares local terms: ppd skin, woman comes, comes physician.NBME_12A Q45
treatment_threshold_methypertension treated with hydrochlorothiazide and osteoarthritis treated with acetaminoantibiotic / antimicrobialprovide clearance to begin volunteer work1lowWhen 'hypertension treated with hydrochlorothiazide and osteoarthritis treated with acetamino' appears, local explanations/choice text favor antibiotic / antimicrobial over provide clearance to begin volunteer work; keyed terms: benign murmurs, otherwise healthy, apparent factors, factors cardiac | distractor terms: bicuspid aortic, aortic valve, valve congenital, congenital valve; weakened by local missing/negative features: no sick contacts, no abnormalities, not smoke cigarettes. Close-distractor signal: choice-specific explanation shares local terms: ppd skin, volunteer work, woman comes.NBME_12A Q45
diagnostic_cluster_vs_mimiclaboratory studies show: leukocyte count segmented neutrophils lymphocytes erythrocytenecrotizing otitis externachronic otitis media with effusion1lowWhen 'laboratory studies show: leukocyte count segmented neutrophils lymphocytes erythrocyte' appears, local explanations/choice text favor necrotizing otitis externa over chronic otitis media with effusion; keyed terms: otitis externa, external ear, ear canal, external ear canal | distractor terms: chronic middle, middle ear, ear pain, pain retrotympanic; weakened by local missing/negative features: no history of ear problems, not seen on this patient. Close-distractor signal: choice-specific explanation shares local terms: left ear, ear pain, ear canal.CMS/Medicine 5A Q9
diagnostic_cluster_vs_mimiclaboratory studies show: leukocyte count segmented neutrophils lymphocytes erythrocytenecrotizing otitis externafungal otitis externa1lowWhen 'laboratory studies show: leukocyte count segmented neutrophils lymphocytes erythrocyte' appears, local explanations/choice text favor necrotizing otitis externa over fungal otitis externa; keyed terms: otitis externa, external ear, ear canal, external ear canal | distractor terms: similarly exam, exam bacterial, bacterial subacute, subacute indolent; weakened by local missing/negative features: no history of ear problems, less likely than bacterial cause. Close-distractor signal: choice-specific explanation shares local terms: left ear, ear canal, man comes.CMS/Medicine 5A Q9
contraindication_or_adverse_effectmultiple over-the-counter topical preparations have provided only temporary resolutionimagingmedication: antibiotic/antimicrobial1lowWhen 'multiple over-the-counter topical preparations have provided only temporary resolution' appears, local explanations/choice text favor imaging over medication: antibiotic/antimicrobial; keyed terms: defect cell-mediated, cell-mediated immunity, defect cell-mediated immunity, esophageal candidiasis | distractor terms: factor developing, developing vulvovaginal, vulvovaginal candidiasis, candidiasis treated; weakened by local missing/negative features: no adnexal tenderness or masses, not explain her long-term. Close-distractor signal: choice-specific explanation shares local terms: treated azithromycin, woman comes, comes physician.NBME_15A Q15
contraindication_or_adverse_effectmultiple over-the-counter topical preparations have provided only temporary resolutionimagingcombined hypogammaglobulinemia1lowWhen 'multiple over-the-counter topical preparations have provided only temporary resolution' appears, local explanations/choice text favor imaging over combined hypogammaglobulinemia; keyed terms: defect cell-mediated, cell-mediated immunity, defect cell-mediated immunity, esophageal candidiasis | distractor terms: x-linked agammaglobulinemia, seen conditions, conditions x-linked, agammaglobulinemia x-linked; weakened by local missing/negative features: no adnexal tenderness or masses, not typically demonstrate susceptibility to viral or fungal. Close-distractor signal: choice-specific explanation shares local terms: x-linked agammaglobulinemia, woman comes, comes physician.NBME_15A Q15
treatment_threshold_metover-the-counter analgesics and nonsteroidal anti-inflammatory drugs has not relievedcardiovascular medicationprocedure: surgery1lowWhen 'over-the-counter analgesics and nonsteroidal anti-inflammatory drugs has not relieved' appears, local explanations/choice text favor cardiovascular medication over procedure: surgery; keyed terms: primary dysmenorrhea, dysmenorrhea defined, defined menstrual, menstrual pain | distractor terms: primary dysmenorrhea, aid multiple, multiple intra-abdominal, intra-abdominal pathologies; weakened by local missing/negative features: no abnormalities, not relieved pain, not associated with any underlying pathology. Close-distractor signal: choice-specific explanation shares local terms: anti-inflammatory drugs, primary dysmenorrhea, apreviously healthy.CMS/PEDS_7A Q22
treatment_threshold_metover-the-counter analgesics and nonsteroidal anti-inflammatory drugs has not relievedcardiovascular medicationnarcotic analgesic therapy1lowWhen 'over-the-counter analgesics and nonsteroidal anti-inflammatory drugs has not relieved' appears, local explanations/choice text favor cardiovascular medication over narcotic analgesic therapy; keyed terms: primary dysmenorrhea, dysmenorrhea defined, defined menstrual, menstrual pain | distractor terms: over-the-counter analgesics, analgesics effective, effective contraceptive, contraceptive significantly; weakened by local missing/negative features: no abnormalities, not relieved pain, not be appropriate at this time, not been effective. Close-distractor signal: choice-specific explanation shares local terms: over-the-counter analgesics, apreviously healthy, brought physician.CMS/PEDS_7A Q22
contraindication_or_adverse_effecthypertension controlled with lisinopril and hyperlipidemia controlled with lovastatinimagingdelusional disorder1lowWhen 'hypertension controlled with lisinopril and hyperlipidemia controlled with lovastatin' appears, local explanations/choice text favor imaging over delusional disorder; keyed terms: dopamine concentration, concentration leads, dopamine concentration leads, pramipexole increases | distractor terms: one delusions, delusions fixed, fixed false, false beliefs; weakened by local missing/negative features: no history of psychiatric illness, without other psychotic symptoms, not demonstrate one circumscribed delusion. Close-distractor signal: choice-specific explanation shares local terms: wife says, examinat ion, man parkinson.CMS/PSYCH 5A Q3
contraindication_or_adverse_effecthypertension controlled with lisinopril and hyperlipidemia controlled with lovastatinimagingmajor depressive disorder1lowWhen 'hypertension controlled with lisinopril and hyperlipidemia controlled with lovastatin' appears, local explanations/choice text favor imaging over major depressive disorder; keyed terms: dopamine concentration, concentration leads, dopamine concentration leads, pramipexole increases | distractor terms: five depressed, depressed mood, mood anhedonia, anhedonia guilt; weakened by local missing/negative features: no history of psychiatric illness, not related to underlying medical condition or. Close-distractor signal: choice-specific explanation shares local terms: wife says, examinat ion, man parkinson.CMS/PSYCH 5A Q3
treatment_threshold_metundergoing total abdominal hysterectomy and bilateral salpingo-oophorectomy under genimagingknowledge patient-controlled analgesia1lowWhen 'undergoing total abdominal hysterectomy and bilateral salpingo-oophorectomy under gen' appears, local explanations/choice text favor imaging over knowledge patient-controlled analgesia; keyed terms: recurrent necrotizing, necrotizing infections, infections chronic, chronic inflammation | distractor terms: cancer-related death, death united, united states, states divided; no repeated missing/negative feature extracted. Close-distractor signal: choice-specific explanation shares local terms: patient-controlled analgesia, woman disoriented, disoriented undergoing.NBME_13A Q38
treatment_threshold_metundergoing total abdominal hysterectomy and bilateral salpingo-oophorectomy under genimagingrisk-management committee prepare1lowWhen 'undergoing total abdominal hysterectomy and bilateral salpingo-oophorectomy under gen' appears, local explanations/choice text favor imaging over risk-management committee prepare; keyed terms: recurrent necrotizing, necrotizing infections, infections chronic, chronic inflammation | distractor terms: neuroendocrine tumor, tumor secretes, secretes substances, substances serotonin; no repeated missing/negative feature extracted. Close-distractor signal: choice-specific explanation shares local terms: woman disoriented, disoriented undergoing, undergoing total.NBME_13A Q38
diagnostic_cluster_vs_mimiclaboratory studies show hematocrit leukocyte count segmented neutrophils lymphocytesdrug-induced neutropeniaimaging1lowWhen 'laboratory studies show hematocrit leukocyte count segmented neutrophils lymphocytes' appears, local explanations/choice text favor drug-induced neutropenia over imaging; keyed terms: adverse effect, drug-induced neutropenia, propylthiouracil methimazole, exhibits hyperthyroidism | distractor terms: radioactive iodine, due myelosuppressive, myelosuppressive effects, effects radioactive; weakened by local missing/negative features: no further details, no skin orjoint abnormalities, not radioactive iodine therapy. Close-distractor signal: choice-specific explanation shares local terms: radioactive iodine, department fever, fever chills.CMS/Medicine 4A Q33
diagnostic_cluster_vs_mimiclaboratory studies show hematocrit leukocyte count segmented neutrophils lymphocytesdrug-induced neutropeniathyroid storm 45% 1400/mm3 5% 95%1lowWhen 'laboratory studies show hematocrit leukocyte count segmented neutrophils lymphocytes' appears, local explanations/choice text favor drug-induced neutropenia over thyroid storm 45% 1400/mm3 5% 95%; keyed terms: adverse effect, drug-induced neutropenia, propylthiouracil methimazole, exhibits hyperthyroidism | distractor terms: thyroid storm, potential complication, complication hyperthyroidism, hyperthyroidism stress; weakened by local missing/negative features: no further details, no skin orjoint abnormalities, not emergently treated. Close-distractor signal: choice-specific explanation shares local terms: thyroid storm, department fever, fever chills.CMS/Medicine 4A Q33
treatment_threshold_metlaboratory studies show hematocrit leukocyte count segmented neutrophils lymphocytescardiovascular medicationinfection / inflammation1lowWhen 'laboratory studies show hematocrit leukocyte count segmented neutrophils lymphocytes' appears, local explanations/choice text favor cardiovascular medication over infection / inflammation; keyed terms: complications kawasaki, high-dose aspirin, lymph node, node multisystem | distractor terms: children fever, fever viral, viral illness, illness appear; weakened by local missing/negative features: without injection adjacent to corneal limbus, rapid streptococcal testing is negative, without suspicion for serious bacterial illness or kawasaki. Close-distractor signal: choice-specific explanation shares local terms: previously healthy, healthy month-old, month-old boy.NBME_14A Q47
treatment_threshold_metlaboratory studies show hematocrit leukocyte count segmented neutrophils lymphocytescardiovascular medication10-day course of oral amoxicillin1lowWhen 'laboratory studies show hematocrit leukocyte count segmented neutrophils lymphocytes' appears, local explanations/choice text favor cardiovascular medication over 10-day course of oral amoxicillin; keyed terms: complications kawasaki, high-dose aspirin, lymph node, node multisystem | distractor terms: suspected bacterial, bacterial infection, infection pneumonia, pneumonia otitis; weakened by local missing/negative features: without injection adjacent to corneal limbus, rapid streptococcal testing is negative, not indicated as cause is not infectious. Close-distractor signal: choice-specific explanation shares local terms: previously healthy, healthy month-old, month-old boy.NBME_14A Q47
treatment_threshold_mether only medication is hydrocodone-acetaminophen hydrocodone 5 mg/acetaminophen 500switch to intravenous morphineadd oral gabapentin to medication regimen1lowWhen 'her only medication is hydrocodone-acetaminophen hydrocodone 5 mg/acetaminophen 500' appears, local explanations/choice text favor switch to intravenous morphine over add oral gabapentin to medication regimen; keyed terms: gastric malignancy, peptic ulcer, chronic gastritis, microcytic anemia | distractor terms: first-line diagnostic, diagnostic potential, potential cholecystitis, cholecystitis characteristic; weakened by local missing/negative features: not have fever or right upper quadrant pain. Close-distractor signal: choice-specific explanation shares local terms: upper gastrointestinal, bilateral mastectomy, woman metastatic.NBME_14A Q32
treatment_threshold_mether only medication is hydrocodone-acetaminophen hydrocodone 5 mg/acetaminophen 500switch to intravenous morphineadd oral ketorolac to medication regimen1lowWhen 'her only medication is hydrocodone-acetaminophen hydrocodone 5 mg/acetaminophen 500' appears, local explanations/choice text favor switch to intravenous morphine over add oral ketorolac to medication regimen; keyed terms: gastric malignancy, peptic ulcer, chronic gastritis, microcytic anemia | distractor terms: small bowel, tissue biopsy, water-soluble contrast, contrast small; weakened by local missing/negative features: not offer opportunity to sample tissue through. Close-distractor signal: choice-specific explanation shares local terms: small bowel, upper gastrointestinal, bilateral mastectomy.NBME_14A Q32
mechanism_from_pathophysiologylaboratory studies show hematocrit leukocyte count segmented neutrophils basophilsimagingvitamin k deficiency1lowWhen 'laboratory studies show hematocrit leukocyte count segmented neutrophils basophils' appears, local explanations/choice text favor imaging over vitamin k deficiency; keyed terms: factor viii, viii deficiency, factor viii deficiency, deficiency hemophilia | distractor terms: unlikely child, child given, given dose, dose vitamin; weakened by local missing/negative features: unlikely because this child was given dose. Close-distractor signal: choice-specific explanation shares local terms: circumcision site, twelve undergoing, undergoing circumcision.CMS/PEDS 5A Q39
mechanism_from_pathophysiologylaboratory studies show hematocrit leukocyte count segmented neutrophils basophilsimagingsepsis1lowWhen 'laboratory studies show hematocrit leukocyte count segmented neutrophils basophils' appears, local explanations/choice text favor imaging over sepsis; keyed terms: factor viii, viii deficiency, factor viii deficiency, deficiency hemophilia | distractor terms: unlikely fever, infection infections, infections sepsis, sepsis newborn; weakened by local missing/negative features: without fever or signs of infection, unlikely diagnosis in this patient without fever or. Close-distractor signal: choice-specific explanation shares local terms: circumcision site, twelve undergoing, undergoing circumcision.CMS/PEDS 5A Q39
next_best_test_after_initial_cluehemoglobin leukocyte count segmented neutrophils bands lymphocytes monocytes serumprimary ciliary dyskinesiaimaging1lowWhen 'hemoglobin leukocyte count segmented neutrophils bands lymphocytes monocytes serum' appears, local explanations/choice text favor primary ciliary dyskinesia over imaging; keyed terms: primary ciliary, ciliary dyskinesia, situs inversus, primary ciliary dyskinesia | distractor terms: disorders impaired, impaired attachment, attachment leukocytes, leukocytes vascular; weakened by local missing/negative features: not to place or time, normal marginated position outside of blood. Close-distractor signal: choice-specific explanation shares local terms: four admission, admission hospital, hospital myocardial.NBME_12A Q25
next_best_test_after_initial_cluehemoglobin leukocyte count segmented neutrophils bands lymphocytes monocytes serumprimary ciliary dyskinesiacomplement deficiency1lowWhen 'hemoglobin leukocyte count segmented neutrophils bands lymphocytes monocytes serum' appears, local explanations/choice text favor primary ciliary dyskinesia over complement deficiency; keyed terms: primary ciliary, ciliary dyskinesia, situs inversus, primary ciliary dyskinesia | distractor terms: particularly terminal, terminal complement, complement proteins, proteins prevents; weakened by local missing/negative features: not to place or time. Close-distractor signal: choice-specific explanation shares local terms: four admission, admission hospital, hospital myocardial.NBME_12A Q25
contraindication_or_adverse_effecthypertension treated with lisinopril and hyperlipidemia treated with atorvastatinponsinternal capsule1lowWhen 'hypertension treated with lisinopril and hyperlipidemia treated with atorvastatin' appears, local explanations/choice text favor pons over internal capsule; keyed terms: strokes ischemic, inferior cerebellar, cerebral infarctions, infarctions known | distractor terms: internal capsule; no repeated missing/negative feature extracted. Close-distractor signal: same local choice set; no choice-specific distractor explanation found.CMS/Neuro 6A Q31
contraindication_or_adverse_effecthypertension treated with lisinopril and hyperlipidemia treated with atorvastatinponsmedulla1lowWhen 'hypertension treated with lisinopril and hyperlipidemia treated with atorvastatin' appears, local explanations/choice text favor pons over medulla; keyed terms: strokes ischemic, inferior cerebellar, cerebral infarctions, infarctions known | distractor terms: not extracted; no repeated missing/negative feature extracted. Close-distractor signal: same local choice set; no choice-specific distractor explanation found.CMS/Neuro 6A Q31
contraindication_or_adverse_effectlisinopril and 20-year history of hypercholesterolemia treated with atorvastatinincreased serum troponin! concentrationpresence of s, gallop1lowWhen 'lisinopril and 20-year history of hypercholesterolemia treated with atorvastatin' appears, local explanations/choice text favor increased serum troponin! concentration over presence of s, gallop; keyed terms: cardiac biomarkers, myocardial infarction, serum troponin, troponin concentration | distractor terms: suggestive ventricular, ventricular hypertrophy, hypertrophy diastolic, diastolic dysfunction; weakened by local missing/negative features: no abnormalities except for s, not associated with acute myocardial infarction. Close-distractor signal: choice-specific explanation shares local terms: t-wave inversion, inversion anterior, anterior lateral.CMS/Medicine 8A Q18
contraindication_or_adverse_effectlisinopril and 20-year history of hypercholesterolemia treated with atorvastatinincreased serum troponin! concentrationchest pain pattern1lowWhen 'lisinopril and 20-year history of hypercholesterolemia treated with atorvastatin' appears, local explanations/choice text favor increased serum troponin! concentration over chest pain pattern; keyed terms: cardiac biomarkers, myocardial infarction, serum troponin, troponin concentration | distractor terms: presented consistent, consistent cardiac, cardiac angina, angina substernal; weakened by local missing/negative features: no abnormalities except for s. Close-distractor signal: choice-specific explanation shares local terms: department episode, episode shortness, shortness breath.CMS/Medicine 8A Q18
contraindication_or_adverse_effectultrasonography confirms absence offetal cardiac activity in otherwise normal-apimagingcesarean delivery1lowWhen 'ultrasonography confirms absence offetal cardiac activity in otherwise normal-ap' appears, local explanations/choice text favor imaging over cesarean delivery; keyed terms: fetal demise, intrauterine fetal, intrauterine fetal demise, delivery antepartum | distractor terms: deliver fetuses, fetuses arrest, arrest labor, labor cephalopelvic; weakened by local missing/negative features: no fetal heart tones are heard on doppler, no glucose or protein, no contractions, not effaced, not typically required in intrauterine fetal demise. Close-distractor signal: choice-specific explanation shares local terms: comes physician, cervix closed, closed effaced.CMS/OBGYN 5A Q26
contraindication_or_adverse_effectultrasonography confirms absence offetal cardiac activity in otherwise normal-apimagingdilatation and curettage1lowWhen 'ultrasonography confirms absence offetal cardiac activity in otherwise normal-ap' appears, local explanations/choice text favor imaging over dilatation and curettage; keyed terms: fetal demise, intrauterine fetal, intrauterine fetal demise, delivery antepartum | distractor terms: elective abortion, abortion remove, remove remaining, remaining fetal; weakened by local missing/negative features: no fetal heart tones are heard on doppler, no glucose or protein, no contractions, not effaced. Close-distractor signal: choice-specific explanation shares local terms: comes physician, cervix closed, closed effaced.CMS/OBGYN 5A Q26
contraindication_or_adverse_effectgastroesophageal reflux disease treated with omeprazole and hypertension treatedurethral hypermobilityconstipation1lowWhen 'gastroesophageal reflux disease treated with omeprazole and hypertension treated' appears, local explanations/choice text favor urethral hypermobility over constipation; keyed terms: pelvic floor, stress urinary, urinary incontinence, multiparous women | distractor terms: urinary incontinence, lead urinary, incontinence via, via direct; weakened by local missing/negative features: no history of gynecologic illness, no abnormalities, no blood, no history of constipation, less likely as cause of her urinary incontinence. Close-distractor signal: choice-specific explanation shares local terms: urinary incontinence, loss urine, previously healthy.NBME_10A Q26
contraindication_or_adverse_effectgastroesophageal reflux disease treated with omeprazole and hypertension treatedurethral hypermobilityhydrochlorothiazide therapy1lowWhen 'gastroesophageal reflux disease treated with omeprazole and hypertension treated' appears, local explanations/choice text favor urethral hypermobility over hydrochlorothiazide therapy; keyed terms: pelvic floor, stress urinary, urinary incontinence, multiparous women | distractor terms: possible urinary, urinary incontinence, incontinence diuretic, diuretic action; weakened by local missing/negative features: no history of gynecologic illness, no abnormalities, no blood. Close-distractor signal: choice-specific explanation shares local terms: urinary incontinence, loss urine, previously healthy.NBME_10A Q26
unstable_patient_stabilizationcardiac examination discloses hyperdynamic precordium and grade 3/6 holosystolicchordae tendineae ruptureimaging1lowWhen 'cardiac examination discloses hyperdynamic precordium and grade 3/6 holosystolic' appears, local explanations/choice text favor chordae tendineae rupture over imaging; keyed terms: chordae tendineae, tendineae rupture, myocardial infarction, mitral valve | distractor terms: given successful, successful coronary, coronary reperfusion, reperfusion thrombolytics; weakened by local missing/negative features: no routine medications, no clubbing, not present on previous examinations, less likely given successful initial coronary reperfusion with. Close-distractor signal: choice-specific explanation shares local terms: myocardial infarction, coronary unit, sudden onset.NBME_11A Q12
unstable_patient_stabilizationcardiac examination discloses hyperdynamic precordium and grade 3/6 holosystolicchordae tendineae ruptureleft ventricular free wall rupture1lowWhen 'cardiac examination discloses hyperdynamic precordium and grade 3/6 holosystolic' appears, local explanations/choice text favor chordae tendineae rupture over left ventricular free wall rupture; keyed terms: chordae tendineae, tendineae rupture, myocardial infarction, mitral valve | distractor terms: another potentially, potentially life-threatening, life-threatening complication, complication myocardial; weakened by local missing/negative features: no routine medications, no clubbing, not present on previous examinations. Close-distractor signal: choice-specific explanation shares local terms: myocardial infarction, man recovering, recovering coronary.NBME_11A Q12
treatment_threshold_metlaboratory studies show leukocyte count segmented neutrophils bands lymphocytesmetformincardiovascular medication1lowWhen 'laboratory studies show leukocyte count segmented neutrophils bands lymphocytes' appears, local explanations/choice text favor metformin over cardiovascular medication; keyed terms: pneumonia elevated, elevated creatinine, creatinine indicating, indicating kidney | distractor terms: cardiovascular medication; no repeated missing/negative feature extracted. Close-distractor signal: choice-specific explanation shares local terms: mild shortness, shortness breath, mild shortness breath.CMS/Medicine_6A Q40
treatment_threshold_metlaboratory studies show leukocyte count segmented neutrophils bands lymphocytesmetforminatenolol1lowWhen 'laboratory studies show leukocyte count segmented neutrophils bands lymphocytes' appears, local explanations/choice text favor metformin over atenolol; keyed terms: pneumonia elevated, elevated creatinine, creatinine indicating, indicating kidney | distractor terms: not extracted; no repeated missing/negative feature extracted. Close-distractor signal: same local choice set; no choice-specific distractor explanation found.CMS/Medicine_6A Q40
contraindication_or_adverse_effectlaboratory studies show leukocyte count segmented neutrophils lymphocytes serumimagingcatatonia1lowWhen 'laboratory studies show leukocyte count segmented neutrophils lymphocytes serum' appears, local explanations/choice text favor imaging over catatonia; keyed terms: autonomic dysfunction, dopamine antagonism, muscle rigidity, neuroleptic malignant | distractor terms: malignant catatonia, neurobehavioral marked, marked inability, inability move; weakened by local missing/negative features: without speaking or following commands, no abnormalities, not fix or follow visual stimuli or gaze, not follow commands, lack of preceding psychiatric symptoms or stereotyped movements. Close-distractor signal: choice-specific explanation shares local terms: leukocyte count, malignant catatonia, department psychiatric.CMS/PYSCH 3A Q10
contraindication_or_adverse_effectlaboratory studies show leukocyte count segmented neutrophils lymphocytes serumimagingmalingering1lowWhen 'laboratory studies show leukocyte count segmented neutrophils lymphocytes serum' appears, local explanations/choice text favor imaging over malingering; keyed terms: autonomic dysfunction, dopamine antagonism, muscle rigidity, neuroleptic malignant | distractor terms: defined falsification, falsification obtain, obtain gain, gain another; weakened by local missing/negative features: without speaking or following commands, no abnormalities, not fix or follow visual stimuli or gaze, not follow commands, no clear secondary gain that he might obtain. Close-distractor signal: choice-specific explanation shares local terms: leukocyte count, department psychiatric, psychiatric hospital.CMS/PYSCH 3A Q10
treatment_threshold_metundergoing pancreaticoduodenectomy for injuries sustained from gunshot wound toenteral tube feedingstotal parenteral nutrition1lowWhen 'undergoing pancreaticoduodenectomy for injuries sustained from gunshot wound to' appears, local explanations/choice text favor enteral tube feedings over total parenteral nutrition; keyed terms: enteral tube, tube feedings, providing nutrition, enteral feeding | distractor terms: parenteral nutrition, forms intravenous, intravenous nutrition, nutrition routes; weakened by local missing/negative features: no nutrients should be given at this time. Close-distractor signal: choice-specific explanation shares local terms: parenteral nutrition, woman remains, remains intensive.CMS/Surgery 4A Q12
treatment_threshold_metundergoing pancreaticoduodenectomy for injuries sustained from gunshot wound toenteral tube feedingsno nutrients should be given at1lowWhen 'undergoing pancreaticoduodenectomy for injuries sustained from gunshot wound to' appears, local explanations/choice text favor enteral tube feedings over no nutrients should be given at; keyed terms: enteral tube, tube feedings, providing nutrition, enteral feeding | distractor terms: surgical healing, healing requires, requires nutritional, nutritional provision; weakened by local missing/negative features: absence of adequate nutrition, not appropriate next step. Close-distractor signal: choice-specific explanation shares local terms: woman remains, remains intensive, intensive unit.CMS/Surgery 4A Q12
screening_age_or_risk_thresholdurine toxicology screening on admission was positive for a-tetrahydrocannabinolpatient-controlled morphinecardiovascular medication1lowWhen 'urine toxicology screening on admission was positive for a-tetrahydrocannabinol' appears, local explanations/choice text favor patient-controlled morphine over cardiovascular medication; keyed terms: pain control, postoperative pain, pain medication, control vital | distractor terms: provide lasting, control pain, improve pain, pain temporarily; weakened by local missing/negative features: not seem to provide lasting benefit, not provide lasting pain control or is an. Close-distractor signal: choice-specific explanation shares local terms: provide lasting, control pain, eight involved.NBME_12A Q26

Top Source Files

Source fileQuestions
NBME/NBME_12A.txt200
NBME/NBME_14A.txt200
NBME/NBME_15A.txt200
NBME/NBME_11A.txt199
NBME/NBME_9A.txt199
NBME/NBME_13A.txt198
NBME/NBME_10A.txt197
CMS/EM_2A.txt50
CMS/EM_3A.txt50
CMS/FM_2A.txt50